8. Dive into Functions¶
8.1. Dive into Functions¶
Functions are a way to package functionalities. There are 4 kinds of functions in Python:
global functions
local functions
lambda functions
methods
Global functions are created with the keyword def and take a name and an optional list of parameters. They are accessible to any code in the same module in which it is created. They can also be accessible from other modules with a mechanism of import.
Local are created as global functions but defined inside other functions (also called nested functions). These functions are visible only to the function where they are defined.
Lambda functions are expressions, so they can be created at their point of use. However, they are much more limited than normal functions.
Methods are functions that are bound to a particular data type and can be used only in conjunction with this data type.
Global functions, local functions and methods are created with the keyword def
and return a value.
To return a value, we explicitly use the keyword return
. If we do not do that, None
is returned by default when the function is called.
We can leave a function at any point by using the return
statement (the yield
statement can also be used, but will not be covered here).
We can call functions by appending parentheses to the function name:
>>> def global_func():
... return "global_func is a global function"
...
>>> print(global_func())
"global_func is a global function"
8.1.1. Names and Docstrings¶
8.1.2. Functions are objects¶
8.1.3. Nested functions¶
It is sometimes useful to have a helper function inside a function. To do this we simply define a function inside the definition of an existing function. Such functions are often called nested functions or local functions:
>>> def outer():
... x = 1
... def inner():
... return 2
... return x + inner()
...
>>> outer()
3
Since functions are objects, a nested function can be returned by the function in which it is defined, assigned to a variable and used via that variable. This is a way to create functions using a function “factory”:
>>> def make_plus_n(n):
... def plus_n(m):
... return n + m
... return plus_n
...
>>> plus_4 = make_plus_n(4)
>>> plus_4(3)
7
>>> plus_4(7)
11
In the above example, make_plus_n
is the “factory”.
It can create different functions depending on the argument it is called with.
For instance, when called with the value 4
as argument,
it creates a function that takes one argument and adds 4
to it.
Note that what is returned by the “factory” is a function object; there are no
parentheses in return plus_n
.
8.1.4. Function arguments vs parameters¶
These two terms, parameter and argument, are sometimes loosely used interchangeably, and the context is used to determine the meaning. The term parameter (sometimes called formal parameter) is often used to refer to the variable as found in the function definition, while argument (sometimes called actual parameter) refers to the actual value passed when the function is called. To avoid confusion, it is common to view a parameter as a variable, and an argument as a value.
Python allows us to pass arguments to functions.
The parameter names become local variable of our function [parameters_and_arguments].
If there are more than one parameter, they are written as a sequence of comma separated identifiers,
or as a sequence of identifier = value
pairs.
For instance, here is a function that calculates the area of a triangle using Heron’s formula:
def heron(a, b, c):
s = (a + b + c) / 2
return math.sqrt(s * (s - a) * (s - b) * (s - c))
Inside the function each parameter, a, b, c, is initialized with the corresponding value that was passed as an argument.
When the function is called, we must supply all arguments, for example, heron(3, 4, 5)
.
If we give too few or too many arguments, a TypeError
exception will be raised.
Doing a call in this way is called using positional arguments, because each argument passed is set as the value for the parameter in the corresponding position. So in this case, a is set to 3, b to 4, and c to 5, when the function is called.
Some functions have parameters for which there can be sensible default.
8.1.5. Arguments and Parameters¶
Python has different ways to define function parameters and pass arguments to them. Function parameters can be either:
positional parameters that are mandatory or named;
keyword parameters that provide a default value.
The parameter syntax does not permit us to put parameters with a default value after parameters that don’t have a default value.
So def bad(a, b = 1, c)
won’t work.
We are not forced to pass our arguments in the order they appear in the function definition.
Instead, we can use keyword arguments, passing each argument in the form name = value
:
>>> def print_arguments(a, b, c = 3, d = 4):
... print("{} {} {} {}".format(a, b, c, d))
...
>>> print_arguments(1, 2)
1 2 3 4
>>> print_arguments(a = 1, b = 2)
1 2 3 4
>>> print_arguments(b = 2, a = 1)
1 2 3 4
Warning
When default values are given, they are created when the def
statement is executed (i.e. when the function is created),
not when the function is called. For immutable arguments like numbers or strings, this doesn’t make any difference,
but for mutable arguments a subtle trap is lurking:
>>> def app(x, lst = []):
... # print the memory adress of the object
... print(id(lst))
... lst.append(x)
... return lst
...
>>> # The default value of the function app is an empty list.
>>> app.__defaults__
([],)
>>> # The memory adress of lst is 140645641579928
>>> app(1)
140645641579928
[1]
>>> app.__defaults__
([1],)
>>> # Now the default value of the app function is list [1]
>>> # The first call to app had a side effect.
>>> app(2)
140645641579928
[1, 2]
>>> # The memory adress does not change (this is the same object as at the first call.
>>> # The list was created at app function creation time.
>>> app.__defaults__
([1, 2],)
Here, the list lst
was created at function creation time.
At each call, Python reuses the same list to add a new element.
This induces an important and dangerous side effect, and usually it is not the desired behavior.
Here is a new version without this side effect:
def app(x, lst = None):
if lst is None:
lst = []
# print the memory adress of the object
print(id(lst))
lst.append(x)
return lst
8.1.5.1. Variable number of parameters¶
A function can take additional optional arguments by prefixing the last parameter with an * (asterisk). Optional arguments are then available in the tuple referenced by this parameter.
Optional variables can also be passed as keywords, if the last parameter is preceded by **. In this case, the optional variables are available within the function as a dictionary.
The operation consisting in getting the arguments passed as sequence is call argument unpacking. Let us see how it works. Especially, there are significant differences between Python 2 and 3.
8.1.5.2. Sequence unpacking¶
Python2 |
Python3 |
---|---|
The unpacking operator does not exist in Python 2 |
We can unpack any iterable (list, tuples, …) with the operator *. When used with two or more variables on the left-hand side of an assignment, one of which is preceded by *, items are assigned to the variables, with all those left over assigned to the starred variables. >>> first, *rest = [1,2,3,4]
>>> first
1
>>> rest
[2, 3, 4]
>>>
>>> first, *mid, last = [1,2,3,4]
>>> first
1
>>> mid
[2, 3]
>>> last
4
|
8.1.5.3. Argument unpacking¶
As the unpacking operator in Python 3, we can use the sequence unpacking operator in a function’s parameter
list (this also works well in Python 2 or Python 3).
This is useful when we want to create functions that can take a variable number of positional arguments.
Here a product
function [prog_in_python3]:
>>> def product(*args):
... result = 1
... for arg in args:
... result *= arg
... return result
...
>>> product(1, 2, 3, 4)
24
>>> product(2, 3)
6
Python 3 supports keywords arguments following positional arguments, even if it’s an unpacking sequence argument:
>>> def func(*args, arg2=None):
... print(args)
... print(arg2)
...
>>> func([1, 2, 3])
([1, 2, 3],)
None
>>> func([1, 2, 3], arg2='a')
([1, 2, 3],)
a
>>> func(1, 2, 3, arg2='a')
(1, 2, 3)
a
Just as we can unpack a sequence to populate a function’s positional arguments, we can unpack a mapping using the mapping unpacking operator ** . We can use ** to pass a dictionary to an argument. Here, the options dictionary’s key-value pairs are unpacked with each key’s value being assigned to the parameter whose name is the same as the key.
A TypeError
is raised if any argument for which the dictionary has no corresponding item is set at this default value:
>>> def func(a=2, b=3):
... print(a, b)
...
>>> func(**{"a": 4, "b": 5})
4 5
>>> func(**{"a": 4, "c": 5})
Traceback (most recent call last):
File "<stdin>", line 1, in <module>
TypeError: func() got an unexpected keyword argument 'c'
>>> func(**{"a": 4})
4 3
We can also use mapping unpacking operator with parameter. In this case, the ** operator must be the last argument:
>>> def func(a=2, b=3, **kwargs):
... print(a)
... print(b)
... print(kwargs)
...
>>> def func(a=2, b=3, **kwargs, d=4):
File "<stdin>", line 1
def func(a=2, b=3, **kwargs, d=4):
^
SyntaxError: invalid syntax
Finally, let’s make a function that prints its “unpackable” arguments to help us understand how it works:
>>> def func(*args, **kwargs):
... print("args =", args)
... print("kwargs =", kwargs)
...
>>> func(1, 2, 3)
args = (1, 2, 3)
kwargs = {}
>>> func([1, 2, 3], a="A", b="B")
args = ([1, 2, 3],)
kwargs = {'a': 'A', 'b': 'B'}
>>> func([1, 2, 3], {"a": "A", "b": "B"})
args = ([1, 2, 3], {'a': 'A', 'b': 'B'})
kwargs = {}
>>> l = [1, 2, 3]
>>> d = {"a": "A", "b": "B"}
>>> func(*l, **d)
args = (1, 2, 3)
kwargs = {'a': 'A', 'b': 'B'}
8.1.6. Scope of variables¶
For variables, Python has function scope, module scope, and global scope (in Python, the term namespaces is often used) [Franklin]. Names enter scope at the start of a context (function, module, or globally), and exit scope when a non-nested function is called or the context ends.
If a name is used prior to variable initialization, this raises a SyntaxError
.
8.1.6.1. Variable resolution rules¶
Although scopes are determined statically, they are used dynamically. At any time during execution, there are at least three nested scopes whose namespaces are directly accessible:
The innermost scope, which is searched first, contains the local names.
The scopes of any enclosing functions, which are searched starting with the nearest enclosing scope, contains non-local, but also non-global names.
The next-to-last scope contains the current module’s global names.
The outermost scope (searched last) is the namespace containing built-in name.
If a variable is simply accessed (not assigned to) in a context,
name resolution follows the LEGB rule (Local, Enclosing, Global, Built-in).
However, if a variable is assigned to, it defaults to creating a local variable,
which is in scope for the entire context. Both these rules can be overridden
with a global
or nonlocal
(in Python 3) declaration prior to use,
which allows accessing global variables even if there is an intervening nonlocal variable,
and assigning to global or nonlocal variables [scope].
We first defined two object references G
and I
which refer respectively to integers 4
and 12
.
Then we created a new object reference func
which refers to the function code
(remember that everything is an object in Python).
When we call the function func with argument 3, Python creates a namespace local to the function, with a first reference object “p” which refers to an integer object with the value 3.
Then, the code of the function is executed, a variable “I” is assigned to, so Python creates a new local reference.
Small arrows show how Python resolves the variables to evaluate the expression “p + I - G”.
Then a reference “res” is created which points to the value of the expression “p + I - G”.
A new reference call “y” to the integer object 4 is created in the global namespace.
The local namespace relative to the function execution is tagged to be removed by the garbage collector. As the int object with 4 as value has another reference (y), it will not be destroyed.
We can see this mechanism in action as in Python we can view the content of the local and the global namespaces
via two built-in functions locals
and globals
.
The code below is written in Python 3.
1 def outer_func():
2 x = 'outer'
3 print('outer locals = ', locals())
4 print(x)
5
6 def inner_func():
7 nonlocal x
8 print('inner locals = ', locals())
9 x = 'inner'
10 print('inner locals = ', locals())
11 print(x)
12
13 inner_func()
14 print('outer locals = ', locals())
15
16 outer_func()
This piece of code illustrates the global and local namespaces.
Although this code is writen in Python 3 the concepts are the same in Python 2.
But the keyword nonlocal
is Python 3 specific.
In Python 2, we can refer to a non local variable, but we cannot assign a new value to a non local variable,
when we try to assign a new value, a new local object reference is created.
When we use the nonlocal
keyword, the variable found in the outer scope is seen as if it belonged to the local scope.
We can manipulate it as a local variable.
If we reassign a new value to this reference, the outer reference is also modified.
8.1.6.2. Variable lifetime¶
It’s also important to note that not only do variables live inside a namespace, they also have lifetimes. Consider the following:
>>> def foo():
... x = 1
...
>>> foo()
>>> print(x)
Traceback (most recent call last):
File "<stdin>", line 1, in <module>
NameError: name 'x' is not defined
It isn’t just scope rules at point #1 that cause a problem (although that’s why we have a NameError
)
it also has to do with how function calls are implemented in Python (and many other languages).
There isn’t any syntax we can use to get the value of the variable x
at this point - it literally doesn’t exist!
The namespace created for our function foo
is created from scratch each time the function is called and it is destroyed when the function ends [Franklin].
8.1.7. Lambda functions¶
In addition TO the def
statement, Python also provides an expression form that generates function objects.
This “lambda” syntax is keyword lambda, followed by one or more arguments (exactly like the arguments list you enclose in parentheses in a def header), followed by an expression after a colon:
Function objects returned by running lambda expressions work exactly the same as those created and assigned by def
s, but there are a few differences that make lambdas useful in specialized roles:
lambda
is an expression, not a statement. Then alambda
can appear in places adef
is not allowed by Python’s syntax:inside a list literal
or a function call’s arguments, for example.
As an expression, lambda returns a value (a new function) that can optionally be assigned a name. In contrast, the
def
statement always assigns the new function to the name in the header, instead of returning it as a result.The body of a
lambda
is a single expression, not a block of statements. The body of alambda
is similar to what you’d put in thereturn
of adef
statement; you simply type the result as a naked expression, instead of explicitly returning it.Because it is limited to an expression, a
lambda
is less general than adef
: you can not put a lot of logic into alambda
body without using statements such asif
. This is by design, to limit program nesting:lambda
is designed for coding simple functions, anddef
handles larger tasks.
Apart from those distinctions, def
s and lambda
s do the same sort of work:
>>> def func(x, y, z): return x + y + z
...
>>> func(2, 3, 4)
9
>>> f = lambda x, y, z: x + y + z
>>> f(2, 3, 4)
9
We can use default arguments or tuple or dict argument like *args or **kwargs exactly as in def
functions.
The code in a lambda
body also follows the same scope lookup rules (LGEB)
as code inside a def
. lambda expressions introduce a local scope much like a nested def
,
which automatically sees names in enclosing functions, the module, and the built-in scope.
8.1.7.1. Why Use lambda?¶
Generally speaking, lambdas come in handy as a sort of function shorthand that allows you to embed a function’s definition
within the code that uses it. They are entirely optional (you can always use def
s instead),
but they tend to be simpler coding constructs in scenarios where you just need to embed small bits of executable code.
For instance, it will very often use in function that take a function as parameter, as sort
, filter
, …
from collections import namedtuple
Sequence = namedtuple("Sequence", ("id", "comment", "sequence"))
sequences = [
Sequence('abcd3_rat', '',
'MAAFSKYLTARNSSLAGAAFLLFCLLHKRRRALGLHGKKSGKPPLQNNEKEGKKERAVVDKVFLSRLSQILKI'),
Sequence('il2_human_matured', 'matured sequence of il2_human',
'APTSSSTKKTQLQLEHLLLDLQMILNGINNYKNPKLTRMLTFKFYMPKKATELKHLQCLEEELKPLEEV'),
Sequence('il2_human', '',
'MYRMQLLSCIALSLALVTNSAPTSSSTKKTQLQLEHLLLDLQMILNGINNYKNPKLTRMLTFKFYMPKKATELKHLQCLE'),
Sequence('TRYP_PIG', '' ,
'FPTDDDDKIVGGYTCAANSIPYQVSLNSGSHFCGGSLINSQWVVSAAHCYKSRIQVRLGE')]
filter(lambda seq: seq.sequence.startswith('M'), sequences)
[Sequence(id='il2_human', comment='',
sequence='MYRMQLLSCIALSLALVTNSAPTSSSTKKTQLQLEHLLLDLQMILNGINNYKNPKLTRMLTFKFYMPKKATELKHLQCLE'),
Sequence(id='abcd3_rat', comment='',
sequence='MAAFSKYLTARNSSLAGAAFLLFCLLHKRRRALGLHGKKSGKPPLQNNEKEGKKERAVVDKVFLSRLSQILKIMVPRTFC')]
sequences.sort(lambda seq1, seq2: len(seq2.sequence)- len(seq1.sequence))
[ (seq.id, len(seq.sequence)) for seq in sequences]
[('il2_human', 80), ('abcd3_rat', 73), ('il2_human_matured', 69), ('TRYP_PIG', 60)]
Without due care, they can lead to unreadable (a.k.a. obfuscated) Python code. In general, simple is better than complex, explicit is better than implicit, and full statements are better than arcane expressions. That’s why lambda is limited to expressions. If you have larger logic to code, use def; lambda is for small pieces of inline code. On the other hand, you may find these techniques useful in moderation.
8.2. References¶
- prog_in_python3
Mark Summerfield, Programming in Python3 (addison wesley): http://www.qtrac.eu/py3book.html
- parameters_and_arguments
http://en.wikipedia.org/wiki/Parameter_(computer_programming)#Parameters_and_arguments
- Franklin(1,2)
Simeon Franklin http://simeonfranklin.com/blog/2012/jul/1/python-decorators-in-12-steps/
- scope
http://en.wikipedia.org/wiki/Scope_(computer_science)#Python
8.3. Exercises¶
8.3.1. Exercise¶
Without executing the code in a Python interpreter, can you determine what the code below prints? Help yourself by drawing a diagram.
Hint locals
returns a dictionary with local variables as keys and their respective values.
x = 4
def func():
y = 5
print(locals())
func()
print(x)
8.3.2. Exercise¶
Without executing the code in a Python interpreter, can you determine what the code below prints? Help yourself by drawing diagram.
Hint locals
returns a dictionary with local variables as keys and their respective values.
x = 4
def func():
y = 5
x = 8
print(locals())
x = x + 2
y = func()
print(y)
print(x)
8.3.3. Exercise¶
Without executing the code in a Python interpreter, can you determine what the code below prints? Help yourself by drawing diagram.
Hint locals
returns a dictionary with local variables as keys and their respective values.
x = 4
def func(a):
y = x + 2
print(locals())
x = y
return y
y = func(x)
print(y)
print(y == x)
8.3.4. Exercise¶
Without executing the code in a Python interpreter, can you determine what the code below prints? Help yourself by drawing diagram.
Hint locals
returns a dictionary with local variables as keys and their respective values.
x = 4
def func(a):
x = x + 2
print(locals())
return x
y = func(x)
print(y)
print(y == x)
8.3.5. Exercice¶
Without executing the code in a Python interpreter, can you determine what the code below prints? Help yourself by drawing diagram.
Hint locals
returns a dictionary with local variables as keys and their respective values.
x = 4
def func(x):
x = x + 2
return x
y = func(x)
print(x)
print(y)
8.3.6. Exercice¶
Without executing the code in a Python interpreter, can you determine what the code below prints? Help yourself by drawing diagram.
Hint locals
returns a dictionary with local variables as keys and their respective values.
def func():
y = x
return y
x = 4
z = func()
print(x)
print(z)
print(id(z) == id(x))
8.3.7. Exercice¶
Without executing the code in a Python interpreter, can you determine what the code below prints? Help yourself by drawing diagram.
Hint locals
returns a dictionary with local variables as keys and their respective values.
x = 4
def func(x = 5):
x = x + 2
return x
y = func()
print(x)
print(y)
8.3.8. Exercice¶
Without executing the code in Python interpreter, can you determine what the code above print out. help you by drawing diagram.
Hint locals print a dictionary with local variable as keys and their respective values.
x = 4
def func(a):
global x
def func2():
print locals()
y = x + 4
return y
z = func2()
return z
y = func(x)
print(x)
print(y)
8.3.9. Exercice¶
Without executing the code in a Python interpreter, can you determine what the code below prints? Help yourself by drawing diagram.
Hint locals
returns a dictionary with local variables as keys and their respective values.
x = {'a' : 4}
def func(a):
a['b'] = 5
return a
y = func(x)
print(x)
print(y)
print(x is y)
8.3.10. Exercice¶
Without executing the code in a Python interpreter, can you determine what the code below prints? Help yourself by drawing diagram.
Hint locals
returns a dictionary with local variables as keys and their respective values.
x = {'a' : 4}
def func(a):
a['b'] = 5
y = func(x)
print(x)
print(y)
8.3.11. Exercice¶
Without executing the code in a Python interpreter, can you determine what the code below prints? Help yourself by drawing diagram.
Hint locals
returns a dictionary with local variables as keys and their respective values.
x = {'a' : 4}
def func(a):
x['b'] = 5
def func2():
a['b'] = 6
return a
y = func(x)
print(x)
print(y)
8.3.12. Exercice¶
Without executing the code in a Python interpreter, can you determine what the code below prints? Help yourself by drawing diagram.
Hint locals
returns a dictionary with local variables as keys and their respective values.
x = {'a' : 4}
def func(a):
x['b'] = 5
def func2():
a['b'] = 6
func2()
return a
y = func(x)
print(x)
8.3.13. Exercice¶
Without executing the code in a Python interpreter, can you determine what the code below prints? Help yourself by drawing diagram.
Hint locals
returns a dictionary with local variables as keys and their respective values.
x = {'a' : 4}
def func(a):
x['b'] = 5
def func2(x):
x['b'] = 6
func2(a.copy())
return a
y = func(x)
print(x)
8.3.14. Exercise¶
Write a function translate
that takes a nucleic acid sequence as parameter, and returns the translated sequence.
We give you a genetic code:
code = { 'ttt': 'F', 'tct': 'S', 'tat': 'Y', 'tgt': 'C',
'ttc': 'F', 'tcc': 'S', 'tac': 'Y', 'tgc': 'C',
'tta': 'L', 'tca': 'S', 'taa': '*', 'tga': '*',
'ttg': 'L', 'tcg': 'S', 'tag': '*', 'tgg': 'W',
'ctt': 'L', 'cct': 'P', 'cat': 'H', 'cgt': 'R',
'ctc': 'L', 'ccc': 'P', 'cac': 'H', 'cgc': 'R',
'cta': 'L', 'cca': 'P', 'caa': 'Q', 'cga': 'R',
'ctg': 'L', 'ccg': 'P', 'cag': 'Q', 'cgg': 'R',
'att': 'I', 'act': 'T', 'aat': 'N', 'agt': 'S',
'atc': 'I', 'acc': 'T', 'aac': 'N', 'agc': 'S',
'ata': 'I', 'aca': 'T', 'aaa': 'K', 'aga': 'R',
'atg': 'M', 'acg': 'T', 'aag': 'K', 'agg': 'R',
'gtt': 'V', 'gct': 'A', 'gat': 'D', 'ggt': 'G',
'gtc': 'V', 'gcc': 'A', 'gac': 'D', 'ggc': 'G',
'gta': 'V', 'gca': 'A', 'gaa': 'E', 'gga': 'G',
'gtg': 'V', 'gcg': 'A', 'gag': 'E', 'ggg': 'G'
}
8.3.14.1. bonus¶
Write an upgrade of the above function that can take the phase as parameter.
8.3.15. Exercise¶
In a new file named matrix.py
Implement a matrix and functions to handle it.
choose the data structure of your choice.
The API (Application Programming Interface) to implement is the following:
- maker
have parameter:
the number of rows
the number of columns
a default value to fill the matrix
and return a matrix of rows_num x col_num
- size
have parameter:
a matrix
return the number of rows, and number of columns
- get_cell
have parameter:
a matrix
the number of rows
the number of columns
the content of cell corresponding to row number x col number
- set_cell
have parameter:
a matrix
the row number of cell to set
the column number of cell to set
the value to set in cell
set the value val in cell specified by row number x column number
- to_str
have parameter:
a matrix
return a string representation of the matrix
- mult
have parameter:
a matrix
val the value to multiply the matrix with
return a new matrix which is the scalar product of matrix x val
- get_row
have parameter:
a matrix
the number of rows
return a copy of the row corresponding to row number
- set_row
have parameter:
a matrix
the row number
the value to put in cells of the row
set value in each cells of the row specify by the row number
- get_col
have parameter:
a matrix
the column number
return a copy of the column corresponding to the column number
- set_col
have parameter:
a matrix
the column number
the value to put in cells
set all cells of a column with value
- replace_col
have parameter:
a matrix
the column number to replace
the list of values to use as replacement of column
replace a column col_no with list of values
- replace_row
have parameter:
a matrix
the row number to replace
the list of values to use as replacement of row
replace a row row_no with list of values